Fashion, Uncategorized

5 PRENDAS BASICAS QUE TE VAN A SALVAR!

Hola! Hace mucho no hablo de moday hoy me parecio muy indicado, quiero contarles de 5 cosas de muchas basicas que siento que todos debemos tener en nuestro closet, que les va ayudar muchisimo a sacarle mas provecho a su closet y no batallar tanto al vestise.


Hello there! I have a long time without talking about Fashion here, I think this a good time [Holidies are coming] I wanted to share with you 5 basics items that in my opinion, we all should have in our closet, this will help you guys a lot and take more advance of your closet.

  1. Basic Knit Cami

Screen Shot 2018-10-14 at 10.24.20 PM.png

Forever 21

Estas ademas de ser muy economicas les juro que sacan de apuros de una menera increible, pueden combinarla con lo mas informal o lo mas formal, todo es cuestion de con que lo acompanes, hay demasiados colores y normalmente no pasan de los 3-5 dolares, van bien con faldas, jeans, shorts CON TODO!


This one is really inexpensive, I swear this will save your life, you can use this with pretty much EVERYTHING, they come in a lot of colors and usually, they are around 3-5 dollars.

2.  CROSSBODY BAG [NEGRO]

 

IMG_6316.jpg

Bolsos que cruzan el cuerpo son lo MAS FACIL DE LLEVAR y tambien van  con todo, tiene un tamano favorable para guardar exactamente lo que necesitas, no te pesan en u solo brazo y vas a estar muy comoda con ellos, sirven para salir a una cita o para irte de fiesta [depende del que escojas]. Este especificamente es mas para el diario pero el negro va con todo y funcionan MUY BIEN.


Crossbodies are the easiest thing to carry around, and they work with everything as well, they usually have a really good size to fit everything in them, you don’t over pack so it doesn’t hurt your arm, they work to go our or for the daily basics [it all depends on which one you choose]. This is especially is more for the daily basis, for the material and the size is black so i can wear it with everything and IT WORKS REALLY GOOD!

3.  White Sneakers 

 

 

 

FUNCIONAN CON TODO! Mejor que tenis negros, ademas de ser comodos te solucionan la vida increible, anos atras yo no entendia como podian usar zapatos todo blancos, me parecian de colegio haha, ahora no puedo vivir sin ellos los uso casi diario y cuando lo sucios [PORQUE HAY QUE USARLOS LIMPIOS] me da un mini infarto porque me solucionan todo mucho mas rapido.


THEY WORK WITH EVERYTHING. Even better than black sneakers, besides of being comfortable they make everything so much easier, year ago I couldn’t understand how people used to wear all WHITE shoes for me they were school shoes, now I literally can’t live without them, I use them almost every single day and when they are dirty [YOU MUST USE THEM CLEAN] I get a mini heart attack because with them everything is so easy that I don’t even have to think too much!

4. BLACK JEANS

jessica-tuttle-660016-unsplash

Salva vida en todos los sentidos, lo pueden usar con todo, no tienes que preocuparte si es muy claro o muy oscuro como pasa con muchos Jeans, visualmente te adelgaza y ademas puedes derrarmete lo que sea y no se va a notar, LOS AMO!


Lifesaver in all the sense, you can use them with EVERYTHING and you don’t have to worry if they are too dark or too light, you look skinnier on them and you can drop whatever and you will good. 🙂

5. SUNGLASSES 

No importa que tan bien vestida estes o que tan mal te veas, siempre te van a dar un toque unico y muy divertido, muchas persona dicen que no les quedan bien pero hay MUCHISIMAS y te aseguro que puedes encontrar unas que se ajusten ati, hay de muchos colores, formas y tamanos, es un accesorio divertido y viene en TODOS los precios.


It doesn’t matter how well dress you are, or how ugly you look, they always going to give you a unique and fun touch, a lot of people say they don’t look good on them, but there’s a lot of sunglasses out there i promise you will find something for you, they come in a lot of shades, shapes, and prices.

 

Advertisements
Standard
Beauty

PROTECTORES SOLARES

Esto es un tema del cual hablo poco pero disfruto mucho, los protectores solares son muy importante en nuestra rutina del cuidado de la piel, muchos creemos que porque usamos bases de maquillaje con SPF o hidratantes con SFP ya estamos protegidas, pero no es el caso. Antes de hablarles de cada uno, quiero contarles una reglas importantes que deben saber sobre los protectores solares.

  1. 4+4=8 No aplica con los protectores solares, es decir, si tienes un hidratante con SPF 30 y usa base con SPF 25 no quiere decir que estas usando SPF 55, no funciona asi, el que mas alto SPF contenga es que que realmente llevas, pero no se cominan.
  2. Incluso cuando este nublado, aunque estes en casa, DEBES USARLO! Siempre estas expuesto al sol, por ende, debes usarlo.
  3. Hay dos tipos de Protectores solares que van a encontrar. Protector Fisico, Protector Quimico.

Como diferenciarlos? INGREDIENTES!

Protector Solar Fisico: Zinc Oxide, Titanium dioxide

Protector Solar Quimico: Avobenzone, Oxybenzone

Ya con eso dicho vamos a entrar con la pequena resena de cada uno.


This is something that I don’t actually talk a lot about but I enjoy it a lot, Sunscreens are super important on your skincare routine, a lot of you guys think just because you are wearing a foundation with SPF or a moisturizer with SPF you are all protected, well no… Before getting into each product I wanted to share with you basic rules about SPF.

  1. 4+4=8 Doesn’t apply on SPF if you wear a 30SPF moisturizer and an SPF 25 Foundation, that doesn’t mean you are wearing SPF 55 altogether, the higher one takes precedent.
  2. You never leave the house without sunscreen, even when is cloudy, even when you are inside, even when it’s rainy you still being exposed to the sun so no matter what, you should wear it.
  3. There’s to type of SPF to look for, there’s a chemical SPF and a Physical SPF, the things you can look for to know which one is which are the INGREDIENTS.

Physical SunScreen: Zinc Oxide, Titanium dioxide

Physical SunScreen: Avobenzone, Oxybenzone

With that being said now we can jump on the review of each product.

Screen Shot 2018-09-25 at 11.04.31 AM

Este no es mi protector solar favorito pero hace el trabajo, si tienes una piel muy grasosa y necesitas re aplicar tu producto funciona muy bien, es un polvo mineral lo cual es muy bueno para personas con piel sencible.


This is not my favourite sunscreen but it does the job, if you have a really oily and need to re-apply your product, it’s a mineral product which is really good for sensitive skin.

Screen Shot 2018-09-25 at 10.59.24 AM

Ojala odiara este producto porque es muy caro para ser un protector solar pero LO AMO!, puede ser un poco complicado con el tema de verte blanca porque es medio complicado de difuminar pero hace que piel se sienta divina.


I wish I hated this because the price but I LOVE it, it could be a little bit tricky with the white cast BUT, it makes your skin feel amazing!

download (1)

Este es el que les recomiendo  a todas las personas que tienes acne o tienes piel grasa, lo use en todo me tratamiento y me funciono muy bien.


This one is the one a recommend for people with acne or super oily skin.

6_8_7_8_3191284

Este es mi protector solar perfecto. No solo protege mi piel, sino que se siente como un humectante simple que usaría todos los días (lo que hago). Tienes que responderlo muy a menudo. Huele a naranjas en flor. Estoy enamorado y lo he recomendado a todos mis amigos y familiares.


This is my perfect sunscreen. Not only is it protecting my skin, it feels like a simple moisturizer that I would use every day (which I do). You have to reply it really often. Smells like oranges blossoms. I’m in love and have recommended it to all my friends and family.

74436

Impresionante para usar sobre la crema hidratante diaria. Evita que mi piel se ponga muy grasosa. El maquillaje se ve muy bien encima de el.


Awesome to use over daily moisturizer. Keeps my skin from getting too greasy. Makeup goes on great after applying this.

 

 

Standard
Beauty

DRUGSTORE FOUNDATION

Hoy es nuestro tercer dia, les voy a compartir esas bases del Drugstore que amo y que aveces uso sobre las mas caras que tengo.


Today in our 3rd day I’m gonna be sharing with you those drugstore foundations I love and sometimes I use them even more than the high-end ones.

L’Oréal Paris Makeup Infallible Pro-Matte Foundation

0.png

Esta es una base INCREIBLE, amo que L’Oreal la haya sacado al mercado. Literal dura mas d e8 horas, no se siente pesada y la piel se ve muy bien, no se ve muy pesada y te deja un efecto como satinado, no es 100% mate. Se difumina muy bien con cualquier herramienta que uses para su aplicacion.


This product is amazing I love that L’Oréal came out with this its genius. It truly lasts for more than 8 hrs it’s lightweight and feels nice in the skin. It’s also not a flat product you have a like a satin finish. Blendable with your fingers or brush. Plus the shade range is great!

L’Oreal Paris Makeup Infallible Up to 24HR Pro-Glow Foundation

50437881

Esta base es divina. Me recuerda mucho a NARS Sheer Glow  pero esta por alguna razon me gusta un poco mas, tiene cobertura de alta a media y te deja un efecto luminoso en la piel, se difumina muy facil en la piel, No se siente cuando la tienes puesta y es muy comoda de llevar.


This foundation is absolutely beautiful. Reminds me so much of NARS Sheer Glow but for some reason, i like this one i little bit better, is light to medium coverage. It gives a beautiful dewy finish, and it blends so easy in your skin. I really don’t feel this foundation on my skin, very comfortable to wear.

No se por donde empezar con esta base, por el precio que tiene su calidad y sus resultado son impresionantes, le va a ir mucho mejor a pieles mixtas o secas, igual si la sellas bien y usas el primer adecuado puede funcionar para piel grasa, tiene una cobertura media que es moldeable, se siente muy ligera y muy comoda de llevar.


I don’t even know where to start with this foundation, for the price and the quality and the results it gives you it just really impressive, it works better for combo to dry skin, if you have oily skin you just have to set it and use a good mattifying primer and it will work too, it has a medium buildable coverage, it feels really light a comfortable to wear.

1_1_8_1_3210253

Esta es una base vieja que hasta estoy segura que ya cambiaron el empaque, PERO hablando ya de la base, esta fue una de mis bases favoritas cuando empece Youtube, eso fue hace casi 4 anos y aun la sigo amando, tiene una finalidad muy natural, buena cobertura y dura muchisimo, LA RECOMIENDO MIL


This an old one, I actually think they changed the packaging so sorry about that, BUT, talking about the foundation, this one my favourite foundation around those years i started youtube, that was almost 4 years ago, and today I’m loving it still, natural finish, good coverage, and awesome longevity, HIGHLY RECOMMEND.

Maybelline New York Fit Me Matte + Poreless

Maybelline-Foundation-FIt-Me-Matte-Poreless-Foundation-Classic-Ivory-041554433449-C

WOW WOW, la base de mi vida y que recomiendo PARA TODO TIPO DE PIEL, es sin duda todo lo que buscas en una base por un precio buenisimo, no se como explicarles lo buena que es, pero tiene TODO TODO lo que necesitas.


WOW WOW, My endless love and the one a RECOMMEND FOR ALL SKIN TYPES, without any doubt this has everything you look in a foundation, I don’t know how to explain how good this is, it has EVERYTHING EVERYTHING YOU NEED.

 

 

MILANI CONCEAL + PERFECT 2-IN-1 FOUNDATION

2930601

Esta es la que mas cobertura tiene de todas, se puede sentir un poco pesada si aplicas mucha cantidad pero con un rostro muy preparado, y buena difuminacion se ve muy bien, dura bastante en la piel y se muy linda y todo lo que pones difumina muy bien.


This is the one with the best coverage of all of them, it could feel a little bit heavy if you apply too much, but if you prep your skin good and blend the foundation it will goo really good, it stays a long time on and it looks flawless.

 

7162JS8xz2L._SY355_

Lo mismo que la de Covergirl, vieja pero INCREIBLE, nunca la he deado de amar, es buenisima, cobertura y alta, tiene un pum, difumina divino y tiene una para cada tipo de piel.


Same as the Covergirl one, OLD BUT AMAZING. Never stop loving it, is really GOOD!! FULL COVERAGE, HAS A PUM, BLENDS BEAUTIFLY AND It has one for oily and another one for dry skin.

 

51kIeuNcbRL._SY355_

Cobertura de media a alta, cobertura satinada a luminosa, no se siente en la piel PARA NADA, dura muchisimo lo cual amo por lo barata que es, no es matte para nada asi que si tienes piel grasa y quieres usarla, usa un primer que te ayuda, para mi, UNA BASE INCREIBLE!


Medium to full coverage. Satin to a dewy finish. Lightweight as HELL, and lasts a good 7 hours which is nice for a cheap foundation that isn’t matte. For me, this is a GREAT foundation!

0 (1)

La mas ”nueva” de todas, lo unico malo que tengo que decir es que se oxida un poco, yo sugiero que se vayan un tono abajo, es una base con mas para pieles grasas, creo que para pieles seca puede ser un poco pesada. Alta cobertura y finalidad muy suave y linda en la piel.


The ”newest” one of all of them, the only bad thing I would say about it, is really oxides so I suggested going a shade down, this foundation is more for oily skin, I think for dry skin it could be a little bit too heavy, hight coverage and the finish is so smooth and beautiful of the skin.

 

COMPRA BASES AQUI:

https://www.amazon.com/shop/johanatorrado

 

Standard
Beauty

DRUGSTORE PRIMERS

Hola!! Hoy es en el dia 2 de #LMTYFaves les voy a compartir mis primers favoritos del drugstore, los que yo he probado y puedo decir que vale la pena.


Hello! Today is the second day of the #LMTYFaves week, I’m going to share with you my favourites drugstore primers, the ones I have tried before and are worth it in my opinion.

ELF PORELESS PRIMER

16602679

Estoy muy complacida con este primer. Es creo que el producto mas barato en mi rutina de maquillaje y he notado como mis poros son menos visibles cuando lo aplico, despues de usarlo por 3 semanas seguidas, no me irrito mi piel que normalmente es muy sencible me deja la piel muy suave.


I’m really pleased with this primer. This is the least expensive product in my beauty routine and I’ve noticed my pores are less visible after using this product for about three weeks. It doesn’t irritate my sensitive skin and leaves my face soft. 

Revlon PhotoReady Face Perfecting Primer

2240010

He luedo cosas malas de este primer y no entiendo porque! Yo la verdad lo probaria antes de juzgar, este primer es divino! De imendiato reduce la apariencia de los poros en mi piel y hace que la base se vea muy bien, tengo piel combo a grasa y usualmente mi base se cuatea en la zona de alrededor de mis labios pero con este primer no! lo recomiendo mucho!


I’ve read some bad reviews on this primer but I don’t see why! I would try it out before making that decision, this primer is incredible! Instantly reduced the look of pores on my skin and held my foundation in so well! I have combo/oily skin and usually, my foundation will start to crease with other primers but this one works so well and keeps it all together! I would so recommend this primer!

Maybelline Facestudio Master Prime Primer, Hydrate + Smooth

maybelline-primer-facestudio-master-blur-hydrate-041554547429-c

Yo no lo odio pero definiticamente no LO AMO. Lo pongo aqui porque no hay muchos primers hidratante en el drugstore y este ayuda lo suficiente, hace que la piel se vea mucho mas pareja y ayuda con la resequedad.


I don’t hate it, but I definitely don’t LOVE it. But for there’s not many hydrating primer at the drugstore so i think this one is a good one, it makes your skin bit smoother and helps with any dryness you may have.

 

 

NYX PROFESSIONAL MAKEUP Angel Veil Skin Perfecting Primer

angelveilskingperfectingprimer_main

Este es mi FAVORITO de todos los de la lista, su concientencia, su aplicaciom, y como ayuda para que la piel se va 10 veces mejor, es WOW! Es parejo a muchos high end primers, y este lo recomiendo mas para piel mixta, sin embargo siento que todo tipo de piel le caeria bien.


This one is definitely TY MY FAVOURITE from the entire list, the consistency, the application and how it helps your skin look 10 times better is your AMAZING! it feels like a high-end primer and i recommend this one a lot, i think it will work better if you have combo skin but i also think it will work for all skin types.

 

Rimmel Stay Matte Primer

14900017

Para mis ninas de piel grasa esto es lo de ustedes, matifica muchisimo y es muy economico.


For my oily skin girl, this one is for you, this helps a lot controlling the oil and is really afforable

 

 

 

THE ORDINARY. High-Adherence Silicone Primer

zb_p

 

Yo estaba dudosa con este tambien porque no soy muy fan de los primer en silicona, pero me sorprendio mucho, no se siente tan silicona como otros y no se siente pesado en la piel, tengo piel combo como ya les he dicho y ayuda mucho a mantener la base en su lugar, sin duda lo recomiendo y lo compraria mil veces.


I was a little sceptical about this primer based on the name and was expecting a thick gloppy silicone gel. I was pleasantly surprised when I first used it and realized it is more of a lotion texture and doesn’t feel heavy on the skin like most silicone primers do. I have combo skin and this really does help lock my foundation into place and keep it matte much longer than a different primer or a foundation by itself. I will certainly repurchase this!

 

COMPREN LOS PRODUCTOS AQUI:

https://www.amazon.com/shop/johanatorrado

Standard
Uncategorized

CURRENT FAVORITES

Hola! Hoy les voy a mostrar mis favoritos del momento que uso TODOS LOS DIAS, es decir que hacen parte de mi rutina diaria, y que recomiendo muchisimo.


Hello! Today I’m going to share with you my current daily favourites these are the product i use on my daily basics and i also highly recommend them.

Beauty Blender

zb_p (1)

Tengo que decir que al principio yo era muy exeptica con la BB pero honestamente en mi opinion, nada difumina la base como esto, LA AMO!


I have to say I was sceptical of this product before I tried it, but honestly, in my opinion, nothing blend a foundation like a Beauty Blender does, love it!

PHILOSOPHY Purity Made Simple Cleanser

75c46b3748f3d37e1e08dd2ab1785169.png

AMO ESTO! Es muy suave con tu piel y disuelve el maquillaje, lo recomiendo mas que la version foam, ya lo llevo usando casi 2 anos y me encanta como remueve el maquillaje sin resecar la piel. LO NECESITAN!


I absolutely love this cleanser! It’s very gentle and does dissolve makeup! I recommend this bottle and cleanser rather than the foam version. I’ve been using this cleanser for about 2 years now, it removes my makeup gently and doesn’t dry out my skin. A must buy!!!

LANEIGE Lip Sleeping Mask

s1966258-main-zoom

He estado este producto como les hhe comentado con la Sleeping Mask de la misma marca (que tambien amo, pero no uso diario) Despues de una sola noche de uso, me desperte con los labios super suaves e hidratados, es una textura suave de un balsamo.


I’ve been using this product in conjunction with the Laneige Sleeping Mask for face. After a night of using this lip mask, I wake up with soft moisturized lips, perfect for lipstick application. The texture of this product feels like a balm and easily absorbs into your lips. 

CAUDALIE Beauty Elixir

caudelie-beauty-elixir-1000x1000_1024x1024

Me lo aplico 10 minitos antes de aplicar el maquillaje, y ya no puedo vivit sin el, el olor es diferente pero no me incomoda. Huele como a menta y es medio fuerte, por eso entiendo que a muchas personas no le guste. Igual es muy refrescante y se siente divino en la piel.


I mist this on about 10 mins before applying my primer and makeup. I now cannot live without this. The smell is different but I really like it. Smells like mint/citrusy… I get why some people may not like it. Anyways is really refreshing and it feels beautiful on the skin.

URBAN DECAY All Nighter Long-Lasting Makeup Setting Spray

s1900000-main-hero-300.jpg

Esto es lo unico que mantiene mi maquillaje TODO EL DIA, y me quita todo aspecto pesado que no me gusta en la piel, es mi sellador favorito en el mundo, llevo muchos anos usandolo y creo que no parare.


This is the only thing that keeps my makeup ALL DAY, it takes away any type of heaviness, is my favourite setting spray ever, i have a lot of years using it i think i will never stop.

NARS Natural Radiant Longwear Foundation

0607845066170

INCREIBLE! Es buenisima para el maquillaje diario, la piel se ve muy suave y subre todas esas imperfecciones o manchas que puedas tener, siempre que la utilizo todo el mundo me pregunta que llevo puesto, sin embargo aveces se me enfatisa alado de mi boca pero nada loco.


Amazing! Great everyday makeup, makes skin look airbrushed, covers my hyper-pigmentation easily! Always get compliments every time I wear it! I do get slight smile lines but nothing crazy.

SUPERGOOP! Unseen Sunscreen Broad Spectrum SPF 40

74436

Se aplica en la piel exactamente como un primer, lo que lo hace perfecto para el uso diario debajo del maquillaje, funciona para todo tipo de piel en mi opinion,


This goes on exactly like a regular primer, which makes it perfect for wearing under daily makeup, it good for all skin types in my opinion.

MARC JACOBS BEAUTY O!Mega Bronzer Coconut Perfect Tan

s2098689-main-zoom

AMO!! y siento que vale toda la pena, yo soy muy picky con los bronzers pero este es perfecto! no es muy naranja no es muy gris, la formula aplica super suave y no se ve sucia ni parchuda. MUY FELIZ.


Love this stuff! I’m very picky with bronzers and this one is perfect! Not too orange and not too grey. The formula is so smooth and doesn’t go on patchy/muddy. SO HAPPY!

TOO FACED Hangover Replenishing Face Primer

70155_1

Odio como huele pero la textura es las divina que lo dejo pasar, hace que mi piel se vea hidratada y que la base no se vea muy cargada, lo recomiendo mas para piel seca.


I hate the smell of it, but the texture is so good and so beautiful but I don’t mind, it makes the skin look so good and hydrated it doesn’t make the foundation look heavy I recommend this for dry skin.

 

Standard
Beauty

SEPHORA VIB SALE RECOMMENDATION

Hoy les voy  a dejar TODAS mis recomendaciones para el VIB SALE de Sephora que está hasta el 3 de septiembre, pueden ahorrar un 10% 15% o 20% depende de la membrecía que tengan, recuerden que esto son productos que me han funcionado ami y a mi tipo de piel que es de Normal a Mixta.


Today i’m gonna share with you guys all my recommendation for the VIB Sale on Sephora. The sale ends on September 3rd. You could save a 10% 15% or 20% all depending on your Sephora membership status. Remember all the recommendation are based on my skin type which is normal to combo skin.

SKINCARE:

1

  • SUPERGOOP! Unseen Sunscreen Broad Spectrum SPF 40 $32.00

  • PHILOSOPHY Purity Made Simple Cleanser $24.00

  • DRUNK ELEPHANT C-Firma™ Day Serum $80.00

  • DRUNK ELEPHANT Protini™ Polypeptide Cream $68.00

  • LANEIGE Water Sleeping Mask $25.00

  • DRUNK ELEPHANT T.L.C. Sukari Babyfacial™ $80.00

PRIMER:

VIB SALE REMMENDATIONS

  • HOURGLASS Veil Mineral Primer $54.00
  • BECCA Backlight Priming Filter Face Primer $38.00

  • SMASHBOX Photo Finish Primerizer $42.00

  • TOO FACED Hangover Replenishing Face Primer $34.00

  • TATCHA The Silk Canvas Protective Primer $52.00

  • BECCA Ever-Matte Poreless Priming Perfector $38.00

FOUNDATION:

3

  • HOURGLASS Vanish™ Seamless Finish Foundation Stick $46.00

  • GIORGIO ARMANI BEAUTY Luminous Silk Foundation $64.00

  • TOO FACED Born This Way Foundation $39.00

  • DIOR Diorskin Forever Perfect Foundation Broad Spectrum SPF 35 $52.00

  • NARS Natural Radiant Longwear Foundation $49.00

  • YVES SAINT LAURENT All Hours Longwear Natural Matte Foundation $54.00

CONCEALER:

4

  • NARS Radiant Creamy Concealer $30.00

  • URBAN DECAY Naked Skin Weightless Complete Coverage Concealer $29.00

  • LAURA MERCIER Secret Camouflage $35.00

  • NARS Soft Matte Complete Concealer $30.00

  • KEVYN AUCOIN The Sensual Skin Enhancer Concealer and Foundation $48.00

  • BECCA Under Eye Brightening Corrector $32.00

POWDERS/ SETTING POWDERS:

5

  • HOURGLASS Veil™ Translucent Setting Powder $46.00
  • TOO FACED Born This Way Ethereal Setting Powder $33.00

  • LAURA MERCIER Translucent Loose Setting Powder $38.00

  • TOO FACED Peach Perfect Mattifying Setting Powder – Peaches and Cream Collection $33.00
  • CHARLOTTE TILBURY Airbrush Flawless Finish Setting Powder $45.00

  • HOURGLASS Ambient® Lighting Powder $46.00

BRONZERS:

6

  • ANASTASIA BEVERLY HILLS Powder Bronzer $28.00

  • TOO FACED Chocolate Soleil Matte Bronzer $30.00

  • BENEFIT COSMETICS Hoola Matte Bronzer $29.00

  • HOURGLASS Ambient® Lighting Bronzer $50.00

  • MARC JACOBS BEAUTY O!Mega Bronzer Coconut Perfect Tan $49.00

  • NARS Sun Wash Diffusing Bronzer $40.00

BLUSHES:

7

  • NARS NARSissist Wanted Cheek Palette $59.00

  • TOO FACED Sweethearts Perfect Flush Blush $30.00

  • HOURGLASS Ambient Lighting Blush Collection #38.00

  • BENEFIT COSMETICS Blush Bar Cheek Palette $58.00

  • TARTE Amazonian Clay 12-Hour Blush $29.00

  • BECCA Mineral Blush $32.00

HIGHLIGHTER:

8

  • COVER FX Custom Enhancer Drops $42.00
  • MARC JACOBS BEAUTY Dew Drops Coconut Gel Highlighter $44.00
  • BECCA Shimmering Skin Perfector® Pressed Highlighter $38.00
  • NARS Highlighting Powder $38.00
  • LAURA MERCIER Matte Radiance Baked Powder Compact $42.00
  • ANASTASIA BEVERLY HILLS Sugar Glow Kit $40.00

SETTING SPRAY:

9

  • CAUDALIE Beauty Elixir $49.99

  • URBAN DECAY All Nighter Long-Lasting Makeup Setting Spray $32.00

  • SMASHBOX Photo Finish Primer Water $32.00

  • TOO FACED Hangover 3-in-1 Replenishing Primer & Setting Spray $32.00

  • MAKE UP FOR EVER Mist & Fix Setting Spray $30.00

EYESHADOW PALETTE:

10

  • ANASTASIA BEVERLY HILLS Soft Glam Eyeshadow Palette $42.00

  • ANASTASIA BEVERLY HILLS  Modern Renaissance Eye Shadow Palette $42.00

  • URBAN DECAY Born To Run Eyeshadow Palette $49.00

  • VISEART Eyeshadow Palette $80.00

  • TARTE Tartelette™ In Bloom Clay Eyeshadow Palette $39.00

  • HUDA BEAUTY Obsessions Eyeshadow Palette $27.00

MASCARAS:

11

  • LANCÔME GRANDIÔSE – Wide-Angle Fan Effect Mascara $32.00

  • HOURGLASS Caution™ Extreme Lash Mascara $29.00

  • MARC JACOBS BEAUTY Velvet Noir Major Volume Mascara $26.00

  • DIOR Diorshow Iconic Overcurl Mascara $29.50

  • TARTE Lights, Camera, Lashes™ 4-in-1 Mascara $23.00

  • URBAN DECAY Perversion Mascara $24.00

EYELINERS:

12

  • STILA Stay All Day® Waterproof Liquid Eye Liner – Micro Tip $22.00
  • MARC JACOBS BEAUTY Highliner Matte Gel Eye Crayon Eyeliner $25.00

  • URBAN DECAY 24/7 Glide-On Eye Pencil $21.00

  • KAT VON D Tattoo Liner $20.00

LIPS:

14

  1. STILAStay All Day® Liquid Lipstick $22.00

  2. FENTY BEAUTY BY RIHANNA Stunna Lip Paint Longwear Fluid Lip Color $24.00

  3. MARC JACOBS BEAUTY Enamored Hi-Shine Lip Lacquer Lipgloss $28.00

  4. SEPHORA COLLECTIONCream Lip Stain Liquid Lipstick $14.00

  5. LANEIGE Lip Sleeping Mask $20.00

TOOLS:

15

  • BEAUTYBLENDER the original beautyblender® $20.00

  • ANASTASIA BEVERLY HILLS Brush #7B $18.00

  • HOURGLASS Veil™ Powder Brush $64.00

  • LA MER The Powder Brush $85.00

Standard
Beauty

ORDEN QUE APLICO MIS PRODUCTOS DEL CUIDADO DE LA PIEL

Como les comente en mi ultimo video, les voy a compartir una corta reseña de cada uno de los productos que mencione en el video, para que tengan una idea de que tipo de piel le funciona mejor y si desean comprarlo tengan un mejor resultado.


As i told you guys on my last video on my Youtube Chanel, today I’m gonna share with you a mini review of each product i mentioned on that video so you guys can have a better idea of how they work.

En ese video les explique el orden en que aplico cada producto del cuidado de la piel en mi rostro, aquí también les dejare los pasos en que lo hago y ahora sin nada mas que decir vamos con las reseñas.


In that video i explained the other i apply every product from my skincare on my face, down below you guys are gonna see the exact order too.

Dia: 

  1. Limpiador.
  2. Tonico.
  3. Hidratante.
  4. Suero de dia.
  5. Protector Solar.

Noche:

  1. Desmaquillante.
  2. Limpiador.
  3. Tónico.
  4. Hidratante.
  5. Suero de noche.
  6. Crema de ojos.
  7. Tratamientos.

Day:

  1. Cleanser.
  2. Tonic Solution.
  3. Moustraizer.
  4. Day Serum.
  5. SunScreen.

Night:

  1. Makeup Remover.
  2. Cleanser.
  3. Tonic Solution.
  4. Moustraizer.
  5. Night Serum.
  6. Eye Cream.
  7. Treatmeans.

TONICOS/ TONIC SOLUTIONS:

ES INCREIBLE, no solo por la cantidad de Ácido glicólico, por su gran tamaño y precio tan bajo el producto en sí mismo va más allá. . de cualquiera que puedas esperar. Exfolia, calma, hidrata, aclara y no irrita. Uno de mis ”top 5”  de la línea de The Ordinary es increíble.


IS INCREDIBLE, Not only do you get an absolutely fantastic amount of Glycolic Acid, a huge size and the cheap pricetah, the product itself goes above and beyond. . It exfoliates, calms, hydrates, brightens, and does not irritate. One of my top 5 products from the line, it’s incredible.

¡Este es un tóner increíble, especialmente si se considera el precio asequible! El envase es simple y la tapa es perfecta para derramar la cantidad correcta en una ronda de algodón y deslizarla en la cara sin ensuciar.  Este tóner está hecho con ingredientes de calidad como hamamelis, agua de rosas y aloe vera. El aloe vera y el agua de rosas son especialmente maravillosos para las personas con piel sensible que luchan contra el enrojecimiento o la irritación después de quitarse el maquillaje.


This is an incredible toner, especially considering the affordable price tag! The packaging is simple and the cap is perfect for pouring out just the right amount on a cotton. This toner is made with quality ingredients like witch hazel, rose water and aloe vera. Aloe vera and rose water are especially wonderful for people with sensitive skin who struggle with redness or irritation after removing makeup.

DESMAQUILLATE / MAKEUP REMOVER:

No creia mucho en este producto antes de comrparlo pensaba que iba a hacer literal un acepte como cualquier balsamo que remueve el maquillaje, de igual manera decidi darle la oportunidad y me enamore, me quita todo sin ningun esfuerzo, con poca cantidad logras quitar mucho maquillaje, dura mucho lo cual hace que tu dinero valga la pena, no me irrita la piel no me pone la piel grasosa, siempre me lavo el rostro despues de usarlo, después de no creer en el se conviertio en mis productos favoritos del cuidado de la piel.


I was very sceptical about this product before I bought because I thought it will be pure oil like any other balm out there, anyways I decided to give it a try and now I’m in love! It removes my waterproof mascara and eyeliner and even liquid lipstick so effortlessly and it is so easy to apply. A little goes a long way so you definitely get your money’s worth with this product. It doesn’t irritate my skin or make it oily, I always wash my face after using it. It has quickly become part of my holy grail skin care products.

La unica crema que me atrevo a poner en mi rostro ya que NUNCA me brota, hace un trabajo increible quitando todo el maquillaje, deja el rostro suave y es muy barata.


The only cream that I dare to put on my face and that NEVER break me out does an incredible job, removes all the makeup, leaves the face soft and is very cheap.

Hasta ahora no puedo decir que es un producto que ha hecho milagros, pero remueve el maquillaje y cualquier exceso de grasa sin tener que hacer muy esfuerzo, no maltrata la piel ni te hace arder el rostro, no se siente la cara pegajosa despues de usarlo, es mucho mas barato que la Bioderma y es igual de bueno en mi opinión, hace su trabajo y pienso que vale la pena.


So far I can’t say this is a miracle product, but it does remove makeup and oils gently, without scrubbing or washing. I like that it doesn’t sting or burn, and it doesn’t leave any sort of film or yucky residue, is cheaper than the Bioderma and is just as good in my opinion, it does the job so i think is totally worth it.

HIDRATANTES / MOISTURIZER:

Este es el hidratante perfecto para personas con piel grasa, hidrata en un punto perfecto, donde vas a tener balanceada y saludable sin nada de grasa. Lo que mas me gusta es lo rapido que se seca, todo es perfecto, menos el precio.


This is the perfect moisturizer for people with oily skin, gives you hydration on the exact point, giving you moisture without feeling oily at all. My favorite thing about this is how quickly and nicely it dries It’s plenty moisturizing for my dry patches and soothing as well. Basically, I like everything except the price.

Perfecto para personas con piel mixta, ustedes saben mi problema con el acne desde que soy adolecente. Simpre que uso un nuevo hidratante suelo tener uno que otro granito con este nunca me paso. agradezco mucho haber descubierto este producto sobre todo porque es muy economico, lo recomiendo muchísimo.


this is perfect for people with combo skin and have been prone to a lot of acne from my teenage. I’ve not had one pimple since using this product, and I always got pimples with every other moisturizer that I’ve ever used. I’m thankful that I found this product, and highly recommend it to anyone looking for an affordable, wonderful moisturizer!

SUERO DE DIA Y NOCHE / DAY & NIGHT SERUM:

Mi piel se ve mucho mas clara y la textura de la piel a mejorado un monton. También me gusta la textura de este suero: proporciona hidratacion pero no grasa. Se absorbe en la piel muy rápido en lugar de sentarse encima. El empaque es hermoso y super practico.


My complexion is brightened and skin texture sees much improvement! I also like the texture of this serum: it provides moisture but not oiliness. It absorbed into skin very quickly instead of sitting on top of it. The packaging is another plus: beautiful and super easy to use.

Este es un producto increible, lo he estado usando por dos meses, y a los 5 dias vi los resultados, mi piel se empezo a ver con menos textura y ya despues de dos meses tengo una piel nueva y 100% mejorada, mis manchas se han disminuido un monton vale cada centavo que cuesta.


This product is incredible. I’ve been using it for about 2 months now. After about 5 days I started to notice a difference in my texture, and now after almost 2 months I basically have new skin. No breakouts my texture is basically gone, and old acne scars have faded tremendously. Worth every cent!
Standard